Cross-cultural interaction between Byzantium and the West, 1204-1669 : whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 / edited by Angeliki Lymberopoulou

The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed signif...

Full description

Saved in:
Bibliographic Details
Superior document:Publications / Society for the Promotion of Byzantine Studies 22
VerfasserIn:
HerausgeberIn:
Place / Publishing House:London, New York : Routledge, Taylor & Francis Group, 2018
Year of Publication:2018
Language:English
Series:Publications / Society for the Promotion of Byzantine Studies 22
Subjects:
Classification:15.29 - Byzantinisches Reich
Online Access:
Physical Description:xxiv, 346 Seiten; Illustrationen, Karten
Notes:Enthält Literaturangaben
Tags: Add Tag
No Tags, Be the first to tag this record!
id 993491106304498
ctrlnum AC15198622
(AT-OBV)AC15198622
(OCoLC)1035464361
(DE-599)BVBBV044893917
(DE-604)BV044893917
(EXLNZ-43ACC_NETWORK)99144829803903331
collection bib_alma
institution YWBYZ
building BYZ-BIB
record_format marc
spelling Spring Symposium of Byzantine Studies 48. 2015 Milton Keynes (DE-588)115694788X aut
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou
London New York Routledge, Taylor & Francis Group 2018
xxiv, 346 Seiten Illustrationen, Karten
txt
n
nc
Publications / Society for the Promotion of Byzantine Studies 22
The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed significantly to the cultural development of modern Europe. The aim of this volume is to address, explore, re-examine and re-interpret one specific aspect of this cross-cultural interaction in the Mediterranean - that between the Byzantine East and the (mainly Italian) West. The investigation of this interaction has become increasingly popular in the past few decades, not least due to the relevance it has for cultural exchanges in our present-day society.0The starting point is provided by the fall of Constantinople to the troops of the Fourth Crusade in 1204. In the aftermath of the fall, a number of Byzantine territories came under prolonged Latin occupation, an occupation that forced Greeks and Latins to adapt their life socially and religiously to the new status quo. Venetian Crete developed one of the most fertile 'bi-cultural' societies, which evolved over 458 years. Its fall to the Ottoman Turks in 1669 marked the end of an era and was hence chosen as the end point for the conference. By sampling case studies from the most representative areas where this interaction took place, the volume highlights the process as well as the significance of its cultural development
Enthält Literaturangaben
Geschichte 1204-1669 gnd
Nachleben im Mittelalter
Byzantinische Geschichte
Konferenzschrift 28.03.2015-30.03.2015 Milton Keynes (DE-588)1071861417 gnd-content
Byzantinisches Reich g (DE-588)4009256-2
Westeuropa g (DE-588)4079215-8
Mittelmeerraum g (DE-588)4074900-9
Kunst s (DE-588)4114333-4
Kulturaustausch s (DE-588)4165964-8
Geschichte 1204-1669 z
AT-OBV DE-604
AT-OBV ubw0228
Lymberopoulou, Angeliki (DE-588)143623559 edt
Erscheint auch als Online-Ausgabe 9781351244954
Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis
KUBIKAT Anreicherung application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis
(AT-OBV)AC00923931 22
YWBYZ BYZ-BIB IBF-LymbCross 2231658390004498
language English
format Conference Proceeding
Book
author2 Lymberopoulou, Angeliki
author_facet Lymberopoulou, Angeliki
Spring Symposium of Byzantine Studies Milton Keynes
author2_variant a l al
author2_role HerausgeberIn
author_corporate Spring Symposium of Byzantine Studies Milton Keynes
author_corporate_role VerfasserIn
author_sort Spring Symposium of Byzantine Studies Milton Keynes
title Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015
spellingShingle Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015
Publications / Society for the Promotion of Byzantine Studies
Byzantinisches Reich (DE-588)4009256-2
Westeuropa (DE-588)4079215-8
Mittelmeerraum (DE-588)4074900-9
Kunst (DE-588)4114333-4
Kulturaustausch (DE-588)4165964-8
Geschichte 1204-1669
title_sub whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015
title_full Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou
title_fullStr Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou
title_full_unstemmed Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou
title_auth Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015
title_new Cross-cultural interaction between Byzantium and the West, 1204-1669
title_sort cross-cultural interaction between byzantium and the west, 1204-1669 whose mediterranean is it anyway? : papers from the forty-eighth spring symposium of byzantine studies, milton keynes, 28th-30th march 2015
series Publications / Society for the Promotion of Byzantine Studies
series2 Publications / Society for the Promotion of Byzantine Studies
publisher Routledge, Taylor & Francis Group
publishDate 2018
physical xxiv, 346 Seiten Illustrationen, Karten
isbn 9780815372677
9781351244954
callnumber-raw IBF-LymbCross
callnumber-search IBF-LymbCross
topic Byzantinisches Reich (DE-588)4009256-2
Westeuropa (DE-588)4079215-8
Mittelmeerraum (DE-588)4074900-9
Kunst (DE-588)4114333-4
Kulturaustausch (DE-588)4165964-8
Geschichte 1204-1669
genre Konferenzschrift 28.03.2015-30.03.2015 Milton Keynes (DE-588)1071861417 gnd-content
era Geschichte 1204-1669 gnd
topic_facet Byzantinisches Reich
Westeuropa
Mittelmeerraum
Kunst
Kulturaustausch
Geschichte 1204-1669
genre_facet Konferenzschrift
geographic_facet Milton Keynes
era_facet Geschichte 1204-1669
28.03.2015-30.03.2015
url http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA
http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA
illustrated Illustrated
dewey-hundreds 300 - Social sciences
dewey-tens 300 - Social sciences, sociology & anthropology
dewey-ones 303 - Social processes
dewey-full 303.482495040902
dewey-sort 3303.482495040902
dewey-raw 303.482495040902
dewey-search 303.482495040902
oclc_num 1035464361
work_keys_str_mv AT springsymposiumofbyzantinestudiesmiltonkeynes crossculturalinteractionbetweenbyzantiumandthewest12041669whosemediterraneanisitanywaypapersfromthefortyeighthspringsymposiumofbyzantinestudiesmiltonkeynes28th30thmarch2015
AT lymberopoulouangeliki crossculturalinteractionbetweenbyzantiumandthewest12041669whosemediterraneanisitanywaypapersfromthefortyeighthspringsymposiumofbyzantinestudiesmiltonkeynes28th30thmarch2015
status_str n
ids_txt_mv (AT-OBV)AC15198622
(OCoLC)1035464361
(DE-599)BVBBV044893917
(DE-604)BV044893917
(EXLNZ-43ACC_NETWORK)99144829803903331
carrierType_str_mv nc
hol852bOwn_txt_mv YWBYZ
hol852hSignatur_txt_mv IBF-LymbCross
hol852cSonderstandort_txt_mv BYZ-BIB
itmData_txt_mv 2021-05-28 13:45:48 Europe/Vienna
barcode_str_mv IBF-298
callnumbers_txt_mv IBF-LymbCross
materialTypes_str_mv BOOK
permanentLibraries_str_mv YWBYZ
permanentLocations_str_mv BYZ-BIB
createdDates_str_mv 2021-05-28 13:45:48 Europe/Vienna
holdingIds_str_mv 2231658390004498
hierarchy_parent_id AC00923931
hierarchy_parent_title Publications / Society for the Promotion of Byzantine Studies 22
hierarchy_sequence 22
is_hierarchy_id AC15198622
is_hierarchy_title Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015
container_title Publications / Society for the Promotion of Byzantine Studies 22
container_reference AC00923931
basiskl_str_mv 15.29 - Byzantinisches Reich
basiskl_txtF_mv 15.29 - Byzantinisches Reich
author2_original_writing_str_mv noLinkedField
_version_ 1793572061197631488
fullrecord <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>04017nam a2200553 cb4500</leader><controlfield tag="001">993491106304498</controlfield><controlfield tag="005">20230514113516.0</controlfield><controlfield tag="007">tu</controlfield><controlfield tag="008">180406s2018 |||a||| |||| 10||| eng c</controlfield><controlfield tag="009">AC15198622</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780815372677</subfield><subfield code="c">hbk.</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(AT-OBV)AC15198622</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1035464361</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044893917</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-604)BV044893917</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(EXLNZ-43ACC_NETWORK)99144829803903331</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">AT-UBW</subfield><subfield code="b">ger</subfield><subfield code="d">AT-OeAW</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="c">XA-GB</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">303.482495040902</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">15.29</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">Spring Symposium of Byzantine Studies</subfield><subfield code="n">48.</subfield><subfield code="d">2015</subfield><subfield code="c">Milton Keynes</subfield><subfield code="0">(DE-588)115694788X</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Cross-cultural interaction between Byzantium and the West, 1204-1669</subfield><subfield code="b">whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015</subfield><subfield code="c">edited by Angeliki Lymberopoulou</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London</subfield><subfield code="a">New York</subfield><subfield code="b">Routledge, Taylor &amp; Francis Group</subfield><subfield code="c">2018</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xxiv, 346 Seiten</subfield><subfield code="b">Illustrationen, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Publications / Society for the Promotion of Byzantine Studies</subfield><subfield code="v">22</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed significantly to the cultural development of modern Europe. The aim of this volume is to address, explore, re-examine and re-interpret one specific aspect of this cross-cultural interaction in the Mediterranean - that between the Byzantine East and the (mainly Italian) West. The investigation of this interaction has become increasingly popular in the past few decades, not least due to the relevance it has for cultural exchanges in our present-day society.0The starting point is provided by the fall of Constantinople to the troops of the Fourth Crusade in 1204. In the aftermath of the fall, a number of Byzantine territories came under prolonged Latin occupation, an occupation that forced Greeks and Latins to adapt their life socially and religiously to the new status quo. Venetian Crete developed one of the most fertile 'bi-cultural' societies, which evolved over 458 years. Its fall to the Ottoman Turks in 1669 marked the end of an era and was hence chosen as the end point for the conference. By sampling case studies from the most representative areas where this interaction took place, the volume highlights the process as well as the significance of its cultural development</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Enthält Literaturangaben</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1204-1669</subfield><subfield code="2">gnd</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Nachleben im Mittelalter</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Byzantinische Geschichte</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Konferenzschrift</subfield><subfield code="y">28.03.2015-30.03.2015</subfield><subfield code="z">Milton Keynes</subfield><subfield code="0">(DE-588)1071861417</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Byzantinisches Reich</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4009256-2</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Westeuropa</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4079215-8</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Mittelmeerraum</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4074900-9</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Kunst</subfield><subfield code="D">s</subfield><subfield code="0">(DE-588)4114333-4</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Kulturaustausch</subfield><subfield code="D">s</subfield><subfield code="0">(DE-588)4165964-8</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1204-1669</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">AT-OBV</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">AT-OBV</subfield><subfield code="5">ubw0228</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lymberopoulou, Angeliki</subfield><subfield code="0">(DE-588)143623559</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">9781351244954</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&amp;doc_library=BVB01&amp;local_base=BVB01&amp;doc_number=030287868&amp;sequence=000001&amp;line_number=0001&amp;func_code=DB_RECORDS&amp;service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">KUBIKAT Anreicherung</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&amp;doc_library=BVB01&amp;local_base=BVB01&amp;doc_number=030287868&amp;sequence=000003&amp;line_number=0002&amp;func_code=DB_RECORDS&amp;service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="w">(AT-OBV)AC00923931</subfield><subfield code="v">22</subfield></datafield><datafield tag="970" ind1="4" ind2=" "><subfield code="b">DE-604</subfield></datafield><datafield tag="970" ind1="2" ind2=" "><subfield code="a">AT-UBW</subfield></datafield><datafield tag="ADM" ind1=" " ind2=" "><subfield code="b">2024-03-15 06:31:55 Europe/Vienna</subfield><subfield code="d">20</subfield><subfield code="f">System</subfield><subfield code="c">marc21</subfield><subfield code="a">2021-05-28 13:38:47 Europe/Vienna</subfield><subfield code="g">false</subfield></datafield><datafield tag="HOL" ind1="8" ind2=" "><subfield code="b">YWBYZ</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="c">BYZ-BIB</subfield><subfield code="8">2231658390004498</subfield></datafield><datafield tag="852" ind1="8" ind2=" "><subfield code="b">YWBYZ</subfield><subfield code="c">BYZ-BIB</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="8">2231658390004498</subfield></datafield><datafield tag="ITM" ind1=" " ind2=" "><subfield code="9">2231658390004498</subfield><subfield code="e">1</subfield><subfield code="m">BOOK</subfield><subfield code="b">IBF-298</subfield><subfield code="2">BYZ-BIB</subfield><subfield code="n">IBF-2879</subfield><subfield code="8">2331658370004498</subfield><subfield code="f">01</subfield><subfield code="p">2021-05-28 13:45:48 Europe/Vienna</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="1">YWBYZ</subfield><subfield code="q">2021-05-28 14:46:01 Europe/Vienna</subfield></datafield></record></collection>