Cross-cultural interaction between Byzantium and the West, 1204-1669 : whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 / edited by Angeliki Lymberopoulou
The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed signif...
Saved in:
Superior document: | Publications / Society for the Promotion of Byzantine Studies 22 |
---|---|
VerfasserIn: | |
HerausgeberIn: | |
Place / Publishing House: | London, New York : Routledge, Taylor & Francis Group, 2018 |
Year of Publication: | 2018 |
Language: | English |
Series: | Publications / Society for the Promotion of Byzantine Studies
22 |
Subjects: | |
Classification: | 15.29 - Byzantinisches Reich |
Online Access: | |
Physical Description: | xxiv, 346 Seiten; Illustrationen, Karten |
Notes: | Enthält Literaturangaben |
Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
id |
993491106304498 |
---|---|
ctrlnum |
AC15198622 (AT-OBV)AC15198622 (OCoLC)1035464361 (DE-599)BVBBV044893917 (DE-604)BV044893917 (EXLNZ-43ACC_NETWORK)99144829803903331 |
collection |
bib_alma |
institution |
YWBYZ |
building |
BYZ-BIB |
record_format |
marc |
spelling |
Spring Symposium of Byzantine Studies 48. 2015 Milton Keynes (DE-588)115694788X aut Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou London New York Routledge, Taylor & Francis Group 2018 xxiv, 346 Seiten Illustrationen, Karten txt n nc Publications / Society for the Promotion of Byzantine Studies 22 The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed significantly to the cultural development of modern Europe. The aim of this volume is to address, explore, re-examine and re-interpret one specific aspect of this cross-cultural interaction in the Mediterranean - that between the Byzantine East and the (mainly Italian) West. The investigation of this interaction has become increasingly popular in the past few decades, not least due to the relevance it has for cultural exchanges in our present-day society.0The starting point is provided by the fall of Constantinople to the troops of the Fourth Crusade in 1204. In the aftermath of the fall, a number of Byzantine territories came under prolonged Latin occupation, an occupation that forced Greeks and Latins to adapt their life socially and religiously to the new status quo. Venetian Crete developed one of the most fertile 'bi-cultural' societies, which evolved over 458 years. Its fall to the Ottoman Turks in 1669 marked the end of an era and was hence chosen as the end point for the conference. By sampling case studies from the most representative areas where this interaction took place, the volume highlights the process as well as the significance of its cultural development Enthält Literaturangaben Geschichte 1204-1669 gnd Nachleben im Mittelalter Byzantinische Geschichte Konferenzschrift 28.03.2015-30.03.2015 Milton Keynes (DE-588)1071861417 gnd-content Byzantinisches Reich g (DE-588)4009256-2 Westeuropa g (DE-588)4079215-8 Mittelmeerraum g (DE-588)4074900-9 Kunst s (DE-588)4114333-4 Kulturaustausch s (DE-588)4165964-8 Geschichte 1204-1669 z AT-OBV DE-604 AT-OBV ubw0228 Lymberopoulou, Angeliki (DE-588)143623559 edt Erscheint auch als Online-Ausgabe 9781351244954 Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis KUBIKAT Anreicherung application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis (AT-OBV)AC00923931 22 YWBYZ BYZ-BIB IBF-LymbCross 2231658390004498 |
language |
English |
format |
Conference Proceeding Book |
author2 |
Lymberopoulou, Angeliki |
author_facet |
Lymberopoulou, Angeliki Spring Symposium of Byzantine Studies Milton Keynes |
author2_variant |
a l al |
author2_role |
HerausgeberIn |
author_corporate |
Spring Symposium of Byzantine Studies Milton Keynes |
author_corporate_role |
VerfasserIn |
author_sort |
Spring Symposium of Byzantine Studies Milton Keynes |
title |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 |
spellingShingle |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 Publications / Society for the Promotion of Byzantine Studies Byzantinisches Reich (DE-588)4009256-2 Westeuropa (DE-588)4079215-8 Mittelmeerraum (DE-588)4074900-9 Kunst (DE-588)4114333-4 Kulturaustausch (DE-588)4165964-8 Geschichte 1204-1669 |
title_sub |
whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 |
title_full |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou |
title_fullStr |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou |
title_full_unstemmed |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 edited by Angeliki Lymberopoulou |
title_auth |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 |
title_new |
Cross-cultural interaction between Byzantium and the West, 1204-1669 |
title_sort |
cross-cultural interaction between byzantium and the west, 1204-1669 whose mediterranean is it anyway? : papers from the forty-eighth spring symposium of byzantine studies, milton keynes, 28th-30th march 2015 |
series |
Publications / Society for the Promotion of Byzantine Studies |
series2 |
Publications / Society for the Promotion of Byzantine Studies |
publisher |
Routledge, Taylor & Francis Group |
publishDate |
2018 |
physical |
xxiv, 346 Seiten Illustrationen, Karten |
isbn |
9780815372677 9781351244954 |
callnumber-raw |
IBF-LymbCross |
callnumber-search |
IBF-LymbCross |
topic |
Byzantinisches Reich (DE-588)4009256-2 Westeuropa (DE-588)4079215-8 Mittelmeerraum (DE-588)4074900-9 Kunst (DE-588)4114333-4 Kulturaustausch (DE-588)4165964-8 Geschichte 1204-1669 |
genre |
Konferenzschrift 28.03.2015-30.03.2015 Milton Keynes (DE-588)1071861417 gnd-content |
era |
Geschichte 1204-1669 gnd |
topic_facet |
Byzantinisches Reich Westeuropa Mittelmeerraum Kunst Kulturaustausch Geschichte 1204-1669 |
genre_facet |
Konferenzschrift |
geographic_facet |
Milton Keynes |
era_facet |
Geschichte 1204-1669 28.03.2015-30.03.2015 |
url |
http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
illustrated |
Illustrated |
dewey-hundreds |
300 - Social sciences |
dewey-tens |
300 - Social sciences, sociology & anthropology |
dewey-ones |
303 - Social processes |
dewey-full |
303.482495040902 |
dewey-sort |
3303.482495040902 |
dewey-raw |
303.482495040902 |
dewey-search |
303.482495040902 |
oclc_num |
1035464361 |
work_keys_str_mv |
AT springsymposiumofbyzantinestudiesmiltonkeynes crossculturalinteractionbetweenbyzantiumandthewest12041669whosemediterraneanisitanywaypapersfromthefortyeighthspringsymposiumofbyzantinestudiesmiltonkeynes28th30thmarch2015 AT lymberopoulouangeliki crossculturalinteractionbetweenbyzantiumandthewest12041669whosemediterraneanisitanywaypapersfromthefortyeighthspringsymposiumofbyzantinestudiesmiltonkeynes28th30thmarch2015 |
status_str |
n |
ids_txt_mv |
(AT-OBV)AC15198622 (OCoLC)1035464361 (DE-599)BVBBV044893917 (DE-604)BV044893917 (EXLNZ-43ACC_NETWORK)99144829803903331 |
carrierType_str_mv |
nc |
hol852bOwn_txt_mv |
YWBYZ |
hol852hSignatur_txt_mv |
IBF-LymbCross |
hol852cSonderstandort_txt_mv |
BYZ-BIB |
itmData_txt_mv |
2021-05-28 13:45:48 Europe/Vienna |
barcode_str_mv |
IBF-298 |
callnumbers_txt_mv |
IBF-LymbCross |
materialTypes_str_mv |
BOOK |
permanentLibraries_str_mv |
YWBYZ |
permanentLocations_str_mv |
BYZ-BIB |
createdDates_str_mv |
2021-05-28 13:45:48 Europe/Vienna |
holdingIds_str_mv |
2231658390004498 |
hierarchy_parent_id |
AC00923931 |
hierarchy_parent_title |
Publications / Society for the Promotion of Byzantine Studies 22 |
hierarchy_sequence |
22 |
is_hierarchy_id |
AC15198622 |
is_hierarchy_title |
Cross-cultural interaction between Byzantium and the West, 1204-1669 whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015 |
container_title |
Publications / Society for the Promotion of Byzantine Studies 22 |
container_reference |
AC00923931 |
basiskl_str_mv |
15.29 - Byzantinisches Reich |
basiskl_txtF_mv |
15.29 - Byzantinisches Reich |
author2_original_writing_str_mv |
noLinkedField |
_version_ |
1793572061197631488 |
fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>04017nam a2200553 cb4500</leader><controlfield tag="001">993491106304498</controlfield><controlfield tag="005">20230514113516.0</controlfield><controlfield tag="007">tu</controlfield><controlfield tag="008">180406s2018 |||a||| |||| 10||| eng c</controlfield><controlfield tag="009">AC15198622</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780815372677</subfield><subfield code="c">hbk.</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(AT-OBV)AC15198622</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1035464361</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV044893917</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-604)BV044893917</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(EXLNZ-43ACC_NETWORK)99144829803903331</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">AT-UBW</subfield><subfield code="b">ger</subfield><subfield code="d">AT-OeAW</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1=" " ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="c">XA-GB</subfield></datafield><datafield tag="082" ind1="0" ind2="4"><subfield code="a">303.482495040902</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">15.29</subfield><subfield code="2">bkl</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">Spring Symposium of Byzantine Studies</subfield><subfield code="n">48.</subfield><subfield code="d">2015</subfield><subfield code="c">Milton Keynes</subfield><subfield code="0">(DE-588)115694788X</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Cross-cultural interaction between Byzantium and the West, 1204-1669</subfield><subfield code="b">whose Mediterranean is it anyway? : papers from the forty-eighth spring symposium of Byzantine studies, Milton Keynes, 28th-30th March 2015</subfield><subfield code="c">edited by Angeliki Lymberopoulou</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London</subfield><subfield code="a">New York</subfield><subfield code="b">Routledge, Taylor & Francis Group</subfield><subfield code="c">2018</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xxiv, 346 Seiten</subfield><subfield code="b">Illustrationen, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Publications / Society for the Promotion of Byzantine Studies</subfield><subfield code="v">22</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">The Early Modern Mediterranean was an area where many different rich cultural traditions came in contact with each other, were often forced to co-exist, and frequently learned to reap the benefits of co-operation. Orthodox, Roman Catholic, Muslims, Jews, and their interactions all contributed significantly to the cultural development of modern Europe. The aim of this volume is to address, explore, re-examine and re-interpret one specific aspect of this cross-cultural interaction in the Mediterranean - that between the Byzantine East and the (mainly Italian) West. The investigation of this interaction has become increasingly popular in the past few decades, not least due to the relevance it has for cultural exchanges in our present-day society.0The starting point is provided by the fall of Constantinople to the troops of the Fourth Crusade in 1204. In the aftermath of the fall, a number of Byzantine territories came under prolonged Latin occupation, an occupation that forced Greeks and Latins to adapt their life socially and religiously to the new status quo. Venetian Crete developed one of the most fertile 'bi-cultural' societies, which evolved over 458 years. Its fall to the Ottoman Turks in 1669 marked the end of an era and was hence chosen as the end point for the conference. By sampling case studies from the most representative areas where this interaction took place, the volume highlights the process as well as the significance of its cultural development</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Enthält Literaturangaben</subfield></datafield><datafield tag="648" ind1=" " ind2="7"><subfield code="a">Geschichte 1204-1669</subfield><subfield code="2">gnd</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Nachleben im Mittelalter</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Byzantinische Geschichte</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Konferenzschrift</subfield><subfield code="y">28.03.2015-30.03.2015</subfield><subfield code="z">Milton Keynes</subfield><subfield code="0">(DE-588)1071861417</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Byzantinisches Reich</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4009256-2</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Westeuropa</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4079215-8</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Mittelmeerraum</subfield><subfield code="D">g</subfield><subfield code="0">(DE-588)4074900-9</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Kunst</subfield><subfield code="D">s</subfield><subfield code="0">(DE-588)4114333-4</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Kulturaustausch</subfield><subfield code="D">s</subfield><subfield code="0">(DE-588)4165964-8</subfield></datafield><datafield tag="689" ind1="0" ind2="5"><subfield code="a">Geschichte 1204-1669</subfield><subfield code="A">z</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">AT-OBV</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">AT-OBV</subfield><subfield code="5">ubw0228</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lymberopoulou, Angeliki</subfield><subfield code="0">(DE-588)143623559</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">9781351244954</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">KUBIKAT Anreicherung</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=030287868&sequence=000003&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="w">(AT-OBV)AC00923931</subfield><subfield code="v">22</subfield></datafield><datafield tag="970" ind1="4" ind2=" "><subfield code="b">DE-604</subfield></datafield><datafield tag="970" ind1="2" ind2=" "><subfield code="a">AT-UBW</subfield></datafield><datafield tag="ADM" ind1=" " ind2=" "><subfield code="b">2024-03-15 06:31:55 Europe/Vienna</subfield><subfield code="d">20</subfield><subfield code="f">System</subfield><subfield code="c">marc21</subfield><subfield code="a">2021-05-28 13:38:47 Europe/Vienna</subfield><subfield code="g">false</subfield></datafield><datafield tag="HOL" ind1="8" ind2=" "><subfield code="b">YWBYZ</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="c">BYZ-BIB</subfield><subfield code="8">2231658390004498</subfield></datafield><datafield tag="852" ind1="8" ind2=" "><subfield code="b">YWBYZ</subfield><subfield code="c">BYZ-BIB</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="8">2231658390004498</subfield></datafield><datafield tag="ITM" ind1=" " ind2=" "><subfield code="9">2231658390004498</subfield><subfield code="e">1</subfield><subfield code="m">BOOK</subfield><subfield code="b">IBF-298</subfield><subfield code="2">BYZ-BIB</subfield><subfield code="n">IBF-2879</subfield><subfield code="8">2331658370004498</subfield><subfield code="f">01</subfield><subfield code="p">2021-05-28 13:45:48 Europe/Vienna</subfield><subfield code="h">IBF-LymbCross</subfield><subfield code="1">YWBYZ</subfield><subfield code="q">2021-05-28 14:46:01 Europe/Vienna</subfield></datafield></record></collection> |