Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells
Saved in:
VerfasserIn: | |
---|---|
Place / Publishing House: | Ottawa : The National Research Council of Canada, 1994 |
Year of Publication: | 1994 |
Language: | ### |
Series: | Biochemistry and Cell Biology
72; 7/8 |
Physical Description: | S. 251-256 |
Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
id |
990000082790504498 |
---|---|
ctrlnum |
YW00008279 (AT-OeAW)YW00008279 (Aleph)000008279OAW01 |
collection |
bib_alma |
institution |
YWOAW |
building |
MAG2-1 |
fullrecord |
<?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam#a2200000#c#4500</leader><controlfield tag="001">990000082790504498</controlfield><controlfield tag="003">AT-OeAW</controlfield><controlfield tag="008">181221|1994####xx############|||#|#####u</controlfield><controlfield tag="009">YW00008279</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">YW00008279</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(AT-OeAW)YW00008279</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(Aleph)000008279OAW01</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Chen, Frank, Y</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="0" ind2="0"><subfield code="a">Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Ottawa</subfield><subfield code="b">The National Research Council of Canada</subfield><subfield code="c">1994</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">S. 251-256</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Biochemistry and Cell Biology</subfield><subfield code="v">72; 7/8</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Amara, Francis M</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Wright, Jim A</subfield><subfield code="4">aut</subfield></datafield><datafield tag="970" ind1="5" ind2=" "><subfield code="a">100450</subfield></datafield><datafield tag="980" ind1="0" ind2=" "><subfield code="a">OAW</subfield><subfield code="9">LOCAL</subfield></datafield><datafield tag="ADM" ind1=" " ind2=" "><subfield code="b">2019-01-13 06:45:15 Europe/Vienna</subfield><subfield code="d">00</subfield><subfield code="f">System</subfield><subfield code="c">marc21</subfield><subfield code="a">2018-12-24 08:38:02 Europe/Vienna</subfield><subfield code="g">false</subfield></datafield><datafield tag="HOL" ind1="8" ind2=" "><subfield code="b">YWOAW</subfield><subfield code="h"> 100450 </subfield><subfield code="c">MAG2-1</subfield><subfield code="8">2217361810004498</subfield></datafield><datafield tag="852" ind1="8" ind2=" "><subfield code="b">YWOAW</subfield><subfield code="c">MAG2-1</subfield><subfield code="h"> 100450 </subfield><subfield code="8">2217361810004498</subfield></datafield><datafield tag="ITM" ind1=" " ind2=" "><subfield code="9">2217361810004498</subfield><subfield code="e">1</subfield><subfield code="m">BOOK</subfield><subfield code="b">@YW000008279</subfield><subfield code="i">OAW-8279</subfield><subfield code="2">MAG2-1</subfield><subfield code="o">20140324</subfield><subfield code="8">2317361800004498</subfield><subfield code="f">02</subfield><subfield code="p">2001-12-17 01:00:00 Europe/Vienna</subfield><subfield code="h">100450</subfield><subfield code="1">YWOAW</subfield><subfield code="q">2022-06-20 23:57:24 Europe/Vienna</subfield></datafield></record></collection> |
record_format |
marc |
spelling |
Chen, Frank, Y aut Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells Ottawa The National Research Council of Canada 1994 S. 251-256 Biochemistry and Cell Biology 72; 7/8 Amara, Francis M aut Wright, Jim A aut YWOAW MAG2-1 100450 2217361810004498 |
format |
Book |
author |
Chen, Frank, Y Amara, Francis M Wright, Jim A |
spellingShingle |
Chen, Frank, Y Amara, Francis M Wright, Jim A Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells Biochemistry and Cell Biology |
author_facet |
Chen, Frank, Y Amara, Francis M Wright, Jim A Amara, Francis M Wright, Jim A |
author_variant |
f y c fy fyc f m a fm fma j a w ja jaw |
author_role |
VerfasserIn VerfasserIn VerfasserIn |
author2 |
Amara, Francis M Wright, Jim A |
author2_role |
VerfasserIn VerfasserIn |
author_sort |
Chen, Frank, Y |
title |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_full |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_fullStr |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_full_unstemmed |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_auth |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_new |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
title_sort |
posttranscriptional regulation of ribonucleotide reductase r1 gene expression is linked to a protein kinase c pathway in mammalian cells |
series |
Biochemistry and Cell Biology |
series2 |
Biochemistry and Cell Biology |
publisher |
The National Research Council of Canada |
publishDate |
1994 |
physical |
S. 251-256 |
callnumber-raw |
100450 |
callnumber-search |
100450 |
illustrated |
Not Illustrated |
work_keys_str_mv |
AT chenfranky posttranscriptionalregulationofribonucleotidereductaser1geneexpressionislinkedtoaproteinkinasecpathwayinmammaliancells AT amarafrancism posttranscriptionalregulationofribonucleotidereductaser1geneexpressionislinkedtoaproteinkinasecpathwayinmammaliancells AT wrightjima posttranscriptionalregulationofribonucleotidereductaser1geneexpressionislinkedtoaproteinkinasecpathwayinmammaliancells |
status_str |
n |
ids_txt_mv |
YW00008279 (AT-OeAW)YW00008279 (Aleph)000008279OAW01 |
hol852bOwn_txt_mv |
YWOAW |
hol852hSignatur_txt_mv |
100450 |
hol852cSonderstandort_txt_mv |
MAG2-1 |
itmData_txt_mv |
2001-12-17 01:00:00 Europe/Vienna |
barcode_str_mv |
@YW000008279 |
callnumbers_txt_mv |
100450 |
inventoryNumbers_str_mv |
OAW-8279 |
materialTypes_str_mv |
BOOK |
permanentLibraries_str_mv |
YWOAW |
permanentLocations_str_mv |
MAG2-1 |
inventoryDates_str_mv |
20140324 |
createdDates_str_mv |
2001-12-17 01:00:00 Europe/Vienna |
holdingIds_str_mv |
2217361810004498 |
is_hierarchy_id |
YW00008279 |
is_hierarchy_title |
Posttranscriptional regulation of ribonucleotide reductase R1 gene expression is linked to a protein kinase C pathway in mammalian cells |
author2_original_writing_str_mv |
noLinkedField noLinkedField |
_version_ |
1787551495658405890 |